Forum |  HardWare.fr | News | Articles | PC | S'identifier | S'inscrire | Shop Recherche
1732 connectés 

  FORUM HardWare.fr
  Programmation
  PHP

  eregi ou preg contre un script java "resize pop up"

 



 Mot :   Pseudo :  
 
Bas de page
Auteur Sujet :

eregi ou preg contre un script java "resize pop up"

n°1269886
Henry2naya
PUTAIN DE MERDE MON CODE MERDE
Posté le 19-12-2005 à 13:46:51  profilanswer
 

Bonjour, je cherche à intégrer une fenetre yahoo, mais j'ai un problème car la fenetre s'auto-resize et ca va pas du tout car je voudrais diviser le pop up en 2 afin de pouvoir regarder le pop up sans qu'il prenne tout l'écran :p
 
voilà l'adresse de la fenetre (testable avec un compte yahoo):
http://launchtoday.fr.launch.yahoo [...] =undefined
 
ou
 
http://launchtoday.fr.launch.yahoo [...] ave&bw=310
 
La fenetre donne comme source:

Citation :


<html><head><!-- SERVER::302 --><title>Yahoo! Music France: Vidéos Musicales</title><script language="javascript" src="http://a1568.g.akamai.net/7/1568/1600/20050217005218/launchtoday.fr.launch.yahoo.com/common/includes/js/common_utility.js"></script><script language="javascript">document.domain = cUtil.scriptDomain;</script>
 
<script language="javascript">
 
   
 function common_mediaplayers_getWMPVersion() {
   
  /*var detectionResults = detectWMP();
  var version = detectionResults.versionInfo;
  alert('detectionResults.versionInfo=' + detectionResults.versionInfo);
  */
   
  var wmpVersionMinor = "6.4";
  var mPlayer = '';
  var wmp7 = "WMPlayer.OCX.7";
   
  try {
     
   if (document.all)
    mPlayer = new ActiveXObject( wmp7 );
   else if ((typeof window.GeckoActiveXObject ? true : false))
    mPlayer = new GeckoActiveXObject( wmp7 );
     
   wmpVersionMinor = mPlayer.versionInfo;
   
  } catch (e) {
   
   //alert(e);
  }
 
  mPlayer = null;
  return String( wmpVersionMinor );
   
 }
 
 function common_mediaplayers_isPlayerSupported() {
 
  var version = common_mediaplayers_getWMPVersion();
  var majorVersion = parseInt(version);
 
  var dot1 = version.indexOf('.');
  var dot2 = version.indexOf('.', dot1+1);
  var dot3 = version.indexOf('.', dot2+1);
 
  var version1 = parseInt( version.substring(dot1+1, dot2) );
  var version2 = parseInt( version.substring(dot2+1, dot3) );
  var version3 = parseInt( version.substring(dot3+1, version.length) );
 
  if (majorVersion == 9)
  {
   if (version1 > 0 || version2 > 0 || version3 >= 2980)
    return true;
   else
    return false;
  }
  else if (majorVersion == 6)
  {
   if (version1 < 4)
    return false;
   else
    return true;
  }  
  else if (majorVersion < 6)
   return false;
  else
   return true;
 }
 
</script>
 
<script language="javascript" src="http://a1568.g.akamai.net/7/1568/1600/20050209011436/launchtoday.fr.launch.yahoo.com/common/includes/js/common_class_cookies.js"></script><script language="javascript">
 var env = '';
 var playerFullVersion = common_mediaplayers_getWMPVersion();
 var mediaHash = 'b00c92754bafd9ed22e9a72dd38816df||1134951116718';
 var oCookie = new common_class_cookies( env );
  oCookie.setCookie('playerFullVersion', playerFullVersion);
  oCookie = null;
   
 var isNetscape = ('Microsoft' == 'Netscape') ? 1:0;
 
 function setWindowSize() {
 
  var wHeight = parseInt(520);
  var wWidth = parseInt(690);
 
  //initial resize to dimensions
  window.resizeTo(wWidth,wHeight);
  //adjust dimensions for inner size differences
  if (self.innerWidth)
  {
   wDelta = (wWidth - self.innerWidth);
   hDelta = (wHeight - self.innerHeight);
  }
  else if (document.documentElement && document.documentElement.clientWidth)
  {
   wDelta = (wWidth - document.documentElement.clientWidth);
   hDelta = (wHeight - document.documentElement.clientHeight);
  }
  else if (document.body)
  {
   wDelta = (wWidth - document.body.clientWidth);
   hDelta = (wHeight - document.body.clientHeight);
  }
   
  //resize with new dimensions
  window.resizeTo((wWidth + wDelta),(wHeight + hDelta));
 }

</script><script language="javascript">
 
    window.focus();
     
 function refreshAd() {
 
 
 }
 
 var isVideoContextAlive = 0;
 function isVideoContextOpen() { return isVideoContextAlive; }
 function setVideoContextStatus(status) { isVideoContextAlive = status; }
 
</script></head><frameset frameborder="0" border="0" framespacing="0" noresize="noresize" onload="setWindowSize()" rows="136,315,69"><frame scrolling="no" frameborder="0" marginwidth="0" marginheight="0" noresize="noresize" name="header" src="/player/header.asp?cid=512&ps=0&sx=p%2Fm.xml&sgm=&uid=1204754644&l=1&im=1&bw=310&vid=&tw=uklmv&env=&bb=Microsoft&bp=Windows%20NT&pb=1&vf=2&cf=1&rf=&paf=3"><frameset frameborder="0" border="0" framespacing="0" noresize="noresize" onload="setWindowSize()" cols="320,370"><frame scrolling="no" frameborder="0" marginwidth="0" marginheight="0" noresize="noresize" name="context" src="/player/videocontext.asp?cid=512&ps=0&sx=p%2Fm.xml&sgm=&uid=1204754644&l=1&im=1&bw=310&vid=&tw=uklmv&env=&bb=Microsoft&bp=Windows%20NT&pb=1&vf=2&cf=1&rf=&paf=3&cfw=320"><frame scrolling="no" frameborder="0" marginwidth="0" marginheight="0" noresize="noresize" name="video" src="/player/videoview.asp?cid=512&ps=0&sx=p%2Fm.xml&sgm=&uid=1204754644&l=1&im=1&bw=310&vid=&tw=uklmv&env=&bb=Microsoft&bp=Windows%20NT&pb=1&vf=2&cf=1&rf=&paf=3&cfw=320"></frameset><frame scrolling="no" frameborder="0" marginwidth="0" marginheight="0" noresize="noresize" name="datawindow" src="/player/dw.asp?cid=512&ps=0&sx=p%2Fm.xml&sgm=&uid=1204754644&l=1&im=1&bw=310&vid=&tw=uklmv&env=&bb=Microsoft&bp=Windows%20NT&pb=1&vf=2&cf=1&rf=&paf=3"></frameset>
</html>
 


 
 
Apparement la fonction javascript est :
function setWindowSize()  
 
j'ai donc essayé ca:
 

Citation :


<?php  
Function Yahoo ($page) {
$fp = fopen($page, "r" ); // lecture de la page
$page="";
while (!feof($fp)) {   //on parcoure toutes les lignes  
$page .= fgets($fp, 4096);  // lecture du contenu de la ligne
}
//$titre = eregi_replace("onload=\"setWindowSize\(\)\"", "dd", $page); //
//$titre = eregi_replace("rows=\"136,315,69\"", "dd", $page); //
$titre = eregi_replace("onload=\"setWindowSize", "dd", $page); //desactive onload
 
///onload: paramètre?
///rows="136,315,69"
//cols="320,370"
 
//$syn2=preg_replace ('function[^0]setWindowSize(.*)resizeTo', 'data', $page);
$titre2 = eregi_replace("src=\"/player", "src=\"http://launchtoday.fr.launch.yahoo.com/player", $titre);
$titre3 = eregi_replace("\"bandwidth.asp\?", "\"http://launchtoday.fr.launch.yahoo.com/player/bandwidth.asp\?", $titre2);//reconfigure les adresses http://
 
 
//echo "<!--".$syn2;
echo $titre3;
 
return;
fclose($fp);
}
 
$page="http://launchtoday.fr.launch.yahoo.com/player/default.asp?cid=512&sx=p%2Fm%2Exml&vid=1&tw=uklmv&redirectURL=%2Fmusicvideos%2F&referer=undefined";
 
//$page="http://launchtoday.fr.launch.yahoo.com/player/bandwidth.asp?cid=512&ps=0&sx=p%2Fm%2Exml&vid=0&tw=uklmv&a=save&bw=310";
 
Yahoo ($page)
 ?>  


 
les autres essais sont indiqués par  "//..."

Mais rien ne marche, impossible de desactiver onload="setWindowSize()"  
 
 
Une autre page est chargée, et le replace la concerne, mais pas la page cible !!! , du coup la fonction resize est toujours active !!:

Citation :


<!--
 
<html>
<head>
<title>Yahoo! Music France: Vidéos Musicales - Détection de la vitesse de connexion</title>
 
<script language="Javascript">
<!--
time = new Date();
var startTime = time.getTime();
// -->
</script>
<!--
SNOHITATUSBKWUJYWBYJNTBPMHQQHHVVPZXGRZGNDZRAODDUH
BHKIYYKHEEQKKSIQFFPCLXHUJHXQQLCORXVBOXLRNNMJKHBGY
CKJMEMGQOEXQNKDULTPVAFCDIDANQOVCFRLJESXNCTKMMFICP
EXCLHWTHRGCBIUHGMGJBMFWPTXIOCQKYDXQJEMFZDBJOXNKVV
RSZIMKRELOUOLNGPMRWJIHENGPJWMFRTPUEUFYCCUJMDDEBSN
OFMTTKXTCQSALKHZURKSHJLYDQJDFCLYOMYFJKHNDNYOXQLRC
TSMEGIUBNTUIYURXWKDYURKAEENKDHQVMFWJITFLGWPJKWPXN
IWGGEJATVHSKUTLCKISIUEPYGXDZQPXOGWCLTGJKNHPFCWDQX
GYVLMTVKFIKEPCFRNFZMALHTWVEDAEJFYWPSEGBVUUILOUOFF
JOJNLOBOFYXZVKUZGERAIRDDHKOIHUIJKVKSQKYQNGPTLXHRW
HJAHZTPPHNUVCOKCLRMKYZPNPCFHAELOOUBKBIPNPIXTOLSEB
GTYJRUBUMFPXYQARYAYCHPUBBOIKNSLICKOTPQUKUSRSFTCGY
UFFGXGGSRTTIVSWGJOJFOQDCQVQLFMYTKMORBQWJDLTJKTLSN
EHCYHPIVIUEICMLPBIDITQYVOPFXIPPTSRTGONOHKJYNPMBJD
QEFJCPSLLISFBWBLSTVFMWVKMJGUONQCSGBHYIQJJIFFLPGRP
PCBEGKPHVWNKAGEQZIGWDOPPRVCKVHRKVLVFSWFZYWNQLEQPV
JBNBJLHYAQPNBSIZHJIJGPSHOOZXGUTKQMMDYEPRDQSULCMOB
KDEIZPHKMCLLYHENJNKGCQJOWLPKBDEETHDBRVNUZNCQIHRKK
FWEKPOSDIAUXHGYFKJIYONDWBUSGYMSKGPOMQTCEDBOYGJWMG
VCDYVVZGRQYLBWEGPJNXOYTKTOLBBJKJQELEYHBUSGUWZHMXX
NWOLUSWETRXVTTMSOEIMWWKYNZLTICWOWUTXBVGHBXZHNJFFD
PPVCFQMHVIYKUUPJPRPBVBEILLVBWGBUBDRHVFGNPPDYKJBWM
KXGOBUMOJESGFILTDLVOTHCQNRJQEXJUEMBTVHLNARYCUBYZR
REEYRWDEHBIXGSVCUUFDQCQMYFHPGICAYSLLMVKSJKGGCUVIK
ZRMVIEXNUPJYJIFTWDXQWTINVEULOCBVZAQYDKMXEVQGBXMRC
AYFWLEHTVGJWVKPFYGAIPJQTSFBGFYEQXHGTTKEODHVRMOGAG
YBVCSHXBPMWLVVCPNULYERRSMZVERHWSKCPDRICQOOVXFESUI
VTKPJNMPTIHWGEEGENYKHRGRIBYHRZJJLSGWUMDFGZAISHIEI
MXBTCQRTKTEXICHQEWELXMZLTSFERZTOKHTGRPFYURCMCQTLA
NPWIHPJOQQERYTYEISGYYVXFXDUSXLXEMJPBJSCGCVFTYUMRH
CIGLIQLVMLQRZBOBPEMLZPTHWVIWNFWMZBYVHFLRHYFQBWBMM
DCJBYZOAPTKOERFPVOYJQDSSWURHLPCDYGWOFWFIBLIQJXSCJ
KOGXKHXSXMIUCCSFJTFIHMYRVMIWPIOBWLOEFPCZXWVYKVKLV
VQKDRDAIPJROHFLLJZIJYHHGRNXLPIECUMLJBYPHMIVSWFDMD
EMVRTBGPZUEPQXNNKMUXQYEWYKYKROKMTRNAQWILXNMFOGNTB
OLNGQIQVIGDUJOGKWIGCIYBXFGPFQNGDREEBEGMQSMISZMFTF
EQGVMDSVJERQWUGWVDCCGGCPMHPALCNPXMGZILXLTDGUCGBGK
SPWUQSYHIPYYSIDNCHJXVFCJTYQMHGSTESEHMIWRQVIJWVVVS
NKQDGTCJBSMSLKUTOJCOLJQPNRCIRSVQCRXYQOTGPMNJIHLVJ
CQQULBLUONVNWJEDSDGCLJQVOYYOLPQGVJOAEULUMCGBHJNVC
RRGMTVWLGJTVEKIEQATNVXRYFHVYTCIGBCTRXDXRUGQPCMUPW
UROCDPNGSRZKAUTNGHCRUBTYMUQFEUQNTMJJITTQKCJFRKFPY
MTYDMGETXDLQNVWQTXPVHDTBUDDJHBRXZRRKJQVYQYSHCSMFE
GTXHFCMMIAHPWDAMXTWVNKVQGYIRUQGKJSWZNYLTYUTMEJYQM
CVBKFDPYBCKRUODJKYNPUTHCLCDLUOCKOPEURQDFXUMUJWYGR
MBYBFSRSNQIVPMSDLJGHEWZKTATSCOBMRRDBMSWRJGGWWMMPP
THILNIMHFCIVPTRWQQGMXPDWBUJDSSZKOLHITGBPEGNATLFIB
CBXBYAIFMQDXKECWGNNEUZBCVTIQEZICXWPRYGBXVFSRQBYXG
MWLZGWDJLPXXWEWRCINQSHHKJQQKMITXODGWQJKJYQHSVCPXD
UFZIINSORNTKKPWECGMFTCISEJQTLKFJWKCZLSHFPYSTOQPRM
CVSLJWDYUROLKAHITYPYCQSGPILZYPNEJYEPJLPVHWCJVWFXY
PDCTJNICQIATMDVVWLNGQNOLHHOUJOLPCKEXWYRCQJXFSWJCR
LOEYIYXWCHMYTQKKILRVMBGJKZLVEMUICXHXKTLTJTBGGJYQW
FFSMFGWJMPKKZQWGXTCESPXBIPSJIYTXTQBJYSFFSVXAQGJVU
TYBSBKZHIXOJCWIJFJNCIJTXIXKGHUVXKCKLMFEVKKFFYYCHA
EKJSJALGYYOKHBNWZQSNKLJXQTRGBAVFBKPPHUMSOCJHTLVIF
FIWBSBDFPOOECHYNWNOCCKXGFMNHXFXHMADCXFDQDPQJEXKCI
XHWSLZOSQVXJXUSWPAQZECLSPDREATHBQLRQVDABQVRRFDCUV
DRTEDEVIPDBVDRNKRMSYKDOHGOTKCWRODGEMLJWOUTQRQTDZQ
IXCBMSJQROSTQWMSKEKFMGDIOWVNCHFZHEKFOWPSYZNJWVLMD
OFNEITWQROXEJUKIGHZXMUDNXBBFXEEMIFPVNGCXXFXOVPMNE
YPCWTNJGOYBPMJNKQODGJPOOXTTBKYWUSFPOHPNWJGZFESGPV
OMXYDMLDOILWLMCWXYVCYZTTCOFYYSWAUMYSGTNAMUKXOIWRX
TFAHVTYQIZRRXEMJRTMQLSXRRIHBKDKJLAUFDUIATYCOWIOLN
RZAOVBHNQSMURJKPRHKUUDKKMZGSIMGQFCYDXTNWTAONNVFTQ
ENYROYUBEKJYOVMRMFDUILFCYYPNBWMGHGPHBVMZJRXGBKQNZ
IRJYIDAJHDOJQFYKFUNSGYTJSJBFDPFKATOBGCYYGBPAQNEHC
OJYGUSZGTHKEXANXLHUJRIOLKMHZYGTMWRBANIAUDUUQDLBTR
KMVKMXOHELWCPOCVKFTQXFEMPUSTWVCPWLWUXWHQNUMJSNOMJ
SPRYIWWNPPITQPFPWOKYEFPMQWIXJOTOXRGWFRJMNKJKGAMME
DSBNBDXFIOQXTTVCFTAOFXKVGKIKWMKNQJPVKGUUXOIXTOEMI
VUFCQFUJAVYYGHGITZUYAYSVWHFHCJJDYQYZNSSVRJQUUBPIM
QGKMJGFBANXLKAVRYOPOYWWXJHEFPWUCYXIQWPFOWQJQDTONE
TOVTOQIFPQLUKWCJQLOLEZYIJHRNVNBQKMJBBGKIKXPPKSYGE
KGXDSVRLIQLOVSTGCFSPWRCMPQWEMJAHURHVNQLRDOVFQEACA
JRNRQXPLQOZJRCTJAJNPXXWJLOBDUTRWVVBUXFOZQOEMOVKSF
CNCHQURHOJKGKUJSENLYJDYQTXZMSYNGKBDEWGSFRKRAIGEZL
FRIVCARCPCYCGLGELXDEXEDXNCQAUWSRJTNZGUULLVOKADFIX
OSUSRFDYUPUGFXSHTDGIXBRTNUABGESVGLGIWJFYXNCISPMGX
QAEDKUVFGJEKDJLCWXOMRBWRVJWFVXOIPRNAXQXBJVDIECZIN
FGCEPYFDXRFQWLDNQEGREHGSWRPGTUBWMCJWTLQXGMLBIGNZJ
WMQFGYVWQYMKEKNFWYWLRDTTCOCDFRMFMJVSCHHFUZVVIPZTL
ODNYVEUGFUEQRNOSPKPCLNHXKJYOTUOOURYMYRUTBEKTTRWKU
GTMODOUUDTFBLZZJOPPQTEKSHRYBMOHPLDPUQKEXCBMPNMMWV
JOZBIYWEYKSLYDSBNSIOGWIJURPNKWANEQFBRGFUELWDNTUBY
CGLLQSXWDGYGYKQXDKFPZIHDJSZRXLNHBUVLITUGBPKILSFNI
UENZXPUKJQULJLKUCFQQCCSTVKBEQHWMMJVBQUCVBOHCEXGRG
ELJJSHNFKWWUWXXRKZXEXWAVIOPOXRYMEHIGUUQSBFKVBNWNT
JKCZDEXLBTFMQYXUNHKJFKRTLLLUORDBIHDAROMLDKRRBWSOO
ZMJKBDEYWGEBORRIHWBMNQVEISMUBCZWHDXGWHSFLXFUVIHTH
CDKHOFQFYZTSCQUXZASFHZNWDWSTGJBZIGJFLBYXBEWGYATQT
SRGHNKBNITQPLOFHMHMJWMFPDCUURFHCABILUEQSNVTNBTSPW
CLNGQVJUGTVDMPPYTSXKHNKLUJERYIYKQIDSVQXHGJDWBKYOQ
RWVEKHGOTRYRTBDWMFTLJYOBWXNGLVWROLQEEXVCGGJGVKBRD
BYXTESMPINNNXYSOUJSLBIGBAKCIUGYOSUQRDUOVMMHKUUSBC
MFEGRXMDQQBVTQDKWBVNTCVPWXVELOFMPCAGABVTPGRFOQZHQ
NCARBWTHWRRXEJDFSURHNKBUJDNSUNMRLEHOHHFFNRYHKVEUO
IEOHLETKDMGDYFNGUYMTHBDHOSMGVUZYJLWFGGCSKRFKPNRJW
RLIELRNFPRNRDGJQCGECMGTUVOQTQRDDEMXGOISIFUERJDDBT
RDGATXDPLRQSBAIAQLUNPFSGWCCPESGFHYYYFQCPUMPXJKGWX
VCNBLFJBGDBWNCYAOPOBGMNSXWKDSSMJXJSGVMGFLEUUXJTXW
KWWFDZEXTHVIMKARZGQSKMMRMDLJUGCVQDGXTRGINTCRIIWAE
GUPSTVUHBKFFBLGPLPUFGYDLYJDAXBUGXGVGTJSXUDWKVDCPA
OGFIIFVCFDJVMXLKOUSCCKQOGUCHCHVXOPPOJKYGECDSGJCUF
YXLZRTKEKDBKQRKGJCRDSDPSJCGJXLJTRRMEMNONZGSCFJPBX
NIRBOHMLBBVQTFSKSVOSFDUCGBETEPOQQCZFONXQTUUHJMQMV
FHIDHOAWQRGKQHYGQDFLLPKBEEWNIBJVEJENGHGZERQIVTHCR
DWMEBERTAGNXMLNLTESCODIHETGKNYZWYEXXTHKHKIQKLEPRP
GYYWCQQFNJKCNSUTZBTIFAJIBEYMVXMVHOCTOSWTWCBZGBFMF
EYFHHRUHJSEYFPNFTPUWKRXSPMUPTRETOOZZBWWXNWYXHPSWW
QMOLRSXFVZZQWWOMUFSBPQXXNLCXFLGFJIXOOELFIDUMNPNGU
IVBNBEVWDXXBSGZXWJQXHDVCSLBFKMDSYTVIEOOBOTATORNMS
JJNDXLGJJDPILJSPXGPZAJGGCAAAOCGHHPXSTHYMXMKIGIYTR
YBPKNOSGRMDTYHEOCUCMQLROXFNUFPZNWIYRJFNQVUXEKUXNO
VHATTMQGRXBHUVTRBFSCHFTFQKSTXARWRHHYELOENNVXRVWFX
HLBAGXQQQHGVZJUAEFMSAUMJKEJLMGFOGTNMGOVLQUESLADLY
QRRUSBVNVWFIHMRDOSXRCRTLDVRUAOPRNTDHSOQAUSEWJVWYT
ALDXVGCGMWRUYGKTBGBGVLVAGLSXZUTHQFCLFMPZKNPSCXCHU
EOQRUBIQFIJTFPZVJBCLEZIWSCHSKUXICKJVMQQHPHDXQMVZB
QGLYIDGPPUQGPRWECTCCRWKUBNHULRHMIHXOPHRKUSPDMJTMD
IGHFXHYGBOIMMBUQRRNWSOFDLKSMYGHDKBSGSFFICPXRCODDU
MPEJCGDJWRPJPRNKICUELTWZEEBMCPIBDKNCPPIXSRYLDUWTU
ZYEHSKGAUPMXLTVKPYUKLHMTJMDCWTVHDRPBGKFYLKBJUYPCU
MLRYMLUJHITBRDPDBKYNMITSLCQTMRXTFWUHNHOJJXMKEXLQC
MISDYFIUMCOUOTBBBZPXIWZTVMESRRJUSLXVNCXMEXINPIJDV
OAEBMXMYALXVBXGBOJGMEDNANFCFKILEUSUTFVOHLLHTIZKIY
ETEFQXYCJCUUQBXYWJZUJCPYHIWHFKNYLAZBCTWXXBTHXXAJQ
KBCEAVXEPOSGFNULMKKDCSHDNOQVDJGDKKTWKYOEPGLSVFUGR
TDLVJNAYNRBSWXNYLREIVFNXJFIKNFBFNYQDSWVZCDGSLQAON
PSTKCJAGTSVIIYNCRLYRPSCRTADZSRTDIESNMUMJYOFOLFGUC
LJEBUTRLBZKKTCPPDICSCUDNMODUWUEXIJCKGQNVAIPAJBKGJ
NCCHOWGDXYSFUMATBIBGDOVOFMURFWYKJIUOGCYFIWLHSGDJI
VEWVGEIQYBUBMQZXUFDJDJJUWHHDUAVJMDKIZPZQYBYEPYTEJ
NDNKHFJVNJOPNVDEEWBFYFHJCGARUJEXCRFJMLBQLRNAJYQVO
OOGZPOBLWFBWLYKDYYJURXFHJNLJXXJPMKNMWNYJYFEZROSZD
HVXPYLJQEJHJCROXDNGQEAFRPLXSZSXITESWGHZPYCWXBQTYG
OZPOCEEWGLGHKFSWTXETOKKJCAHXFLTGCOJSCOPPBIVNPCMFC
IDOHWGATKCSHWNSNSQRYRDHEKGQGXTGLRJSHSHJMUYMSKIFGH
BNOVXLCKBTGXRNJVOFLFPZRCPFNGKFQYFEVGDQEDYWNKLODNK
BTPLKTYRYMRWGEOVSQFWKVIPZXQEYGNNICFXDDGUTOBXVEXPG
YAJGMVQFKXBEBQOBIHFRERQPRPRODSDRPXRROKSMWNFTYPFGK
DKRICWOSOHXKVBDOHCIKVNWGSUHLHDXFBTOYFERQIXLKACOSI
RPLWRLJVBGVKXERGJWNWDYGCTRNAUCYHPCDJWFFCAEOSGYRCK
FKVLLNDXEFQYREOAIVZSEQTWOBCVJDUAZBVUEJTOKVQDKIIDV
YQXJPFVBRGHKXSJVTTTDQHWYVWAGHXAEWZDWYPBBVXGCZBPHB
ICKIYZIOBGHYOWVCXYRQIQEAAKLGDWUGHJYGBCCMYMNGQWJXD
CUOPSWOFLOOGJYULHXJVHRZKKZCJEHULFIPTOTVJXLWQGHDPM
GOQTSLERSJZWEEQXGRAGJIEPCCPPIPOPASRQSIZWUYVFMJNWP
SRXEKMBNCLQOQBJFVIDFYSTEUFHUVUUKOCTSMBZVTKNPQVJXS
TJSUCXXVJGQYIISFLXOYQBBCTKWBTGDIINTHVBCXOHNFWBONB
OFGCWEXWKAFPSVOHSXSWTQYDOAXERYKEVFTDEFEYSMOCLEHYD
QQWTRWHFPOBWYSEXCWNNFTHMVOBBCMOWNIQRFPJJWMHGOMFXJ
BDQGOEVQNGEQYKFCHZEGZQGICQNVMQBOQQEINWAJWLMWSTEVV
RWVYJYLVWIUSTLGBXSLNSCOCLQVQYZJMMMAMVQVCVHMAVGXSR
BRMXFTNBIMPFUDOEQUJJNZHGCWJDPEBTSBHUPNOZDXNVURMOY
GOESMUXJCPWSLLXKOVQJIQCUEIDBORKFJZPJTBQUCQMRIHWUH
DSSTFCXFWIUINMXEOWQLLEAYLDSIZNNFXHSIOVECDSELMPUSD
ISBKHSRVDYZZPGKGRQNFBGWXQHNWNNCQFSBIUNHUTNVRVPWYD
NYMNSPGIJBEBSFAUVZPLDVFHPKLCIRYYPCVBIHYBMOTYCEDKF
LQBDJYBJGSBYUEKBNRKQXZCWOBZFZXIYYVJFWZGYVWPGJMTXS
JKKOGURQLYUSGTHZQFBLEGNTJLUHUJMGJTGHOJBHJQMJBBIDL
IHBLGFNOKIQBLVPBIUBYDDBFUYZGLGVQMOTQOFRWGKNEGDJVU
SXGJBLJHVPRGFTPNOOTMPSSTSWYDNADBRYKIABGUUFITJIUEX
OQIQFMSYTKIFDIUJDHHEIGEMWCGVDPGISGHLQPXTGKDIGVWJN
UOQVUDOQUYVQLMJCLSEPMDUHWVZVCAKEWLPDIMRNMFNLRSTSE
VXPMDRZRSKMLACBLFGRFBNOXHYCTREPHAYEBRDITBSRJRCFJC
RCVORSDKKBCFEVSLIUPPSKBCCAFSBSOKCWQVWEXYZVBANKJLH
CNQEEJEQYJAQPXKPNAQTUGDVCCXUIEIXNFQDRRNOCIHOVJLKP
JTYRBGDFOTSQAIKQCIFZWMBWLIJNVSPQDXDXEPBVWFWKUSWZN
MDDWHEXDWUQEOKFQZXMNLRLNDZQLUOCZWNCPGCSTUNGIGYSJS
BJBBFOUGRJVWOLVIAYXPBVTVDIFBLUSVDRQSVTEJQQWGAQNPH
STQDSPTHZRGYZCFTLFTQNAHLLNDDEKNALASMAPJRGRDRTVOSQ
PKWKTTVVQUAPXTVDPBIEFKYCDYTRLSOIVYPYUOLWDPVKLFKUK
WTSURUOWAKHGKZNSSBRONWOWTUEKPJNKOYGUAURWPRCSLQHGX
IDLKWXWPAKFSJIKJDGQDROBAVPFOFPGWPTVXBBXKQPHJDGJOI
FRUBDHNYLEQIOQWBGEYAVBKUJYHGGELUTJWOMLJHBZJPEJEUZ
UGMMAXSFTHJLTGQJCBXPMVWYBOTLHBBPFODWVFOPYDFUAHBOG
FSOIHXTUALLIVWOSROEKPKECPJKVVDXHARKUXPXPMHELTNKUK
LHOILJLMOHEFCXNILCWBBBXTXQLDDSVNLIHRVTNPJKWQCELXP
SMYLPCQCYIFTYGTGHLYTVRRNWWLGCLOWHLXXDOWJCYHSSLYLG
YKIGINPRDWSHXAXVSFQFSGLCGQBMUWSESJSJWXJWLFRHGCKLF
DSIBOZYCOXUSITDRBCVSPJMTTIOWOXBVXKZUPQUKIOGQBFERU
PDILHNBUSSFFESLXUUNEBOCFBHYURHQVKUADVBDPCHPUUNAJB
GOYWIBMOLCLVNNMQKGMPCYMOSNELLKOJVIUTDFMHIKRKWFBNL
KHHQKQIQJAUOOTUEGNKYLKJKIJZMNSDKWJNTLLMNNENWJHPSR
VLWRPXFHFGHMWQXDKAMWDGXJKGKRJXBCOMXVIEIRBVIYTGLNG
JVSYSJJNPFNIVRVMHCVWFFWPKQVQCNMRFVUGDJXHIHRLPDIJK
LNNFLJSQGBUISKLHOCHNMKLZSDZIXBZNBVNJOLEEFLOCNSJEZ
KJEFFVHMTGEQHDJVRETCPRQOADNNUEOESREDUFWQMMHTNPMXY
TQNFCTIPVVEBSCEYPRSNIKGEAVVDDPHPPCKREDMEZEBWSLYYK
WOVANHTCYKOOJALXIILQLDNUQRSYHPRIWDDBXUFZVYEPKCMAL
SVJIHRPLPYHGDAQXATEGUIAPDKDLOPEPFJCLYNRSIAKYOVRBS
FECKBLLIQUBLQRAHIPMEWHQKHEDXDSNTVWFNINMDHNXUPUULF
RBZTSJJEHKHSAKSCBEHZPXCTASRIVDHKDVLAGBSCOKQNVXCIL
RRBWVSMBCBSBDHHRMNNDUZLUUANNFJYVKTHSMOULRYSSYAHDR
IHRUTQTHMNHKELBYNSIXEFXFLGEUYUHBUDFGNCGLBMMSXDVAA
FBKZBJGOEQVSHXFCYXHVEBASIIGGLZGGQDAQSLMJJKETBUWCS
EAFIWPOXCEQUHHIXVXPRYPUUTYQOSSXHFQEXOWPEDPQPNUFAN
HLITFXJAJWGLJPPIIGKXMWBQTUGLLXTJHQAPZVYKPBLTLENTE
YERDKJZUPDWWOCSCUFGPMNGSQQMQPZVKXPPKFCKWPROTCXWTK
-->
 
 
<script language="Javascript1.1">
<!--
 
//// calculate download time
time = new Date();
var endTime = time.getTime();
if (startTime == endTime) {
 var downloadTime = .01;
} else {
 var downloadTime = (endTime - startTime)/1000; //conversion to seconds
}
var bandwidth_KBps = 10 / downloadTime;
var bandwidth_Kbps = 100 / downloadTime;
 
var redirectTime = 0;
var goHere = "http://launchtoday.fr.launch.yahoo.com/bandwidth.asp\?cid=512&ps=0&sx=p%2Fm%2Exml&vid=0&tw=uklmv&a=save&bw=" + parseInt( bandwidth_Kbps );
 
function redirectUser() {
 
 setTimeout("go_now()", redirectTime);
}
 
function go_now() {
 
 window.location.replace(goHere);
}
 
//-->
</script>
 
<script language="javascript" src="http://a1568.g.akamai.net/7/1568/1600/20050517162845/launchtoday.fr.launch.yahoo.com/common/includes/js/common_mediaplayer_getWMP.js"></script>
<script language="javascript" src="http://a1568.g.akamai.net/7/1568/1600/20050209011436/launchtoday.fr.launch.yahoo.com/common/includes/js/common_class_cookies.js"></script>
<script>
  var oCookie = new common_class_cookies( "" );
  oCookie.setCookie( 'playerFullVersion', parseFloat( common_mediaplayers_getWMPVersion() ) );
  oCookie = null;
</script>
 
<style type="text/css">
 
.mainFont {
 font-family: verdana, arial;
 font-size: 8pt'
}
</style>
 
</head>
<body bgcolor="#464677" text=#FFFFFF onload="redirectUser()">
<table width="100%" height="100%" cellspacing="0" cellpadding="0" border="0">
 <tr>
  <td align="center" valign="middle" class="mainFont"><b>Détection de la vitesse de connexion...</b><br></td>
 </tr>
</table>
</body>
</html>  @@-->  


 
Si quelqu'un pouvait m'aider svp...
 
Merci
 
NaY :bounce:


Message édité par Henry2naya le 19-12-2005 à 15:54:47
mood
Publicité
Posté le 19-12-2005 à 13:46:51  profilanswer
 


Aller à :
Ajouter une réponse
  FORUM HardWare.fr
  Programmation
  PHP

  eregi ou preg contre un script java "resize pop up"

 

Sujets relatifs
Problème execution VB Script en ASP[Java] avis sur ce procédé de remplacement de suspend() / resume()
koi installé j2se ? pb de java sous firefox suite à l'install de j2se[Java] synchro entre thread: wait() et notify() -> pb [RESOLU]
Boutique virtuelle en java en utilisant Strutspreg et retour chariot
du script avec du html[Java] maj du défilement d'un jtextarea utilisé par 2 classes
[VBS] Recuperer une valeur depuis un autre scriptUpload en JAVA
Plus de sujets relatifs à : eregi ou preg contre un script java "resize pop up"


Copyright © 1997-2018 Hardware.fr SARL (Signaler un contenu illicite / Données personnelles) / Groupe LDLC / Shop HFR